Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653

  1. Avatar for dembones 31. dembones Lv 1 53 pts. 9,555
  2. Avatar for g_b 32. g_b Lv 1 52 pts. 9,549
  3. Avatar for pmdpmd 33. pmdpmd Lv 1 51 pts. 9,545
  4. Avatar for sheerbliss 34. sheerbliss Lv 1 50 pts. 9,533
  5. Avatar for pvc78 35. pvc78 Lv 1 49 pts. 9,529
  6. Avatar for Idiotboy 36. Idiotboy Lv 1 48 pts. 9,528
  7. Avatar for smholst 37. smholst Lv 1 47 pts. 9,517
  8. Avatar for O Seki To 38. O Seki To Lv 1 46 pts. 9,480
  9. Avatar for jermainiac 39. jermainiac Lv 1 45 pts. 9,478
  10. Avatar for YeshuaLives 40. YeshuaLives Lv 1 43 pts. 9,472

Comments