Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653
  1. Avatar for Glen B 51. Glen B Lv 1 33 pts. 9,385
  2. Avatar for ManVsYard 52. ManVsYard Lv 1 33 pts. 9,385
  3. Avatar for TomTaylor 53. TomTaylor Lv 1 32 pts. 9,375
  4. Avatar for isaksson 54. isaksson Lv 1 31 pts. 9,374
  5. Avatar for Satina 55. Satina Lv 1 30 pts. 9,372
  6. Avatar for jamiexq 56. jamiexq Lv 1 30 pts. 9,359
  7. Avatar for diamonddays 57. diamonddays Lv 1 29 pts. 9,359
  8. Avatar for Crossed Sticks 58. Crossed Sticks Lv 1 28 pts. 9,357
  9. Avatar for TastyMunchies 59. TastyMunchies Lv 1 27 pts. 9,355
  10. Avatar for Deleted player 60. Deleted player 27 pts. 9,351

Comments