Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653
  1. Avatar for caglar 61. caglar Lv 1 26 pts. 9,340
  2. Avatar for ecali 62. ecali Lv 1 25 pts. 9,338
  3. Avatar for guineapig 63. guineapig Lv 1 25 pts. 9,330
  4. Avatar for Marvelz 64. Marvelz Lv 1 24 pts. 9,325
  5. Avatar for tarimo 65. tarimo Lv 1 23 pts. 9,317
  6. Avatar for DodoBird 66. DodoBird Lv 1 23 pts. 9,316
  7. Avatar for yoyoparis 67. yoyoparis Lv 1 22 pts. 9,314
  8. Avatar for altejoh 68. altejoh Lv 1 22 pts. 9,276
  9. Avatar for hansvandenhof 69. hansvandenhof Lv 1 21 pts. 9,274
  10. Avatar for andrewxc 70. andrewxc Lv 1 21 pts. 9,270

Comments