Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653
  1. Avatar for Superphosphate 81. Superphosphate Lv 1 15 pts. 9,216
  2. Avatar for petetrig 82. petetrig Lv 1 15 pts. 9,215
  3. Avatar for t012 83. t012 Lv 1 14 pts. 9,211
  4. Avatar for Deleted player 84. Deleted player pts. 9,209
  5. Avatar for Festering Wounds 85. Festering Wounds Lv 1 14 pts. 9,206
  6. Avatar for SKSbell 86. SKSbell Lv 1 13 pts. 9,201
  7. Avatar for WBarme1234 87. WBarme1234 Lv 1 13 pts. 9,199
  8. Avatar for crpainter 88. crpainter Lv 1 12 pts. 9,196
  9. Avatar for BCAA 89. BCAA Lv 1 12 pts. 9,195
  10. Avatar for weitzen 90. weitzen Lv 1 12 pts. 9,192

Comments