Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,807
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,738
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,712
  4. Avatar for Go Science 4. Go Science 49 pts. 9,702
  5. Avatar for Contenders 5. Contenders 37 pts. 9,700
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,620
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,611
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 9,480
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,402
  10. Avatar for Deleted group 10. Deleted group pts. 9,386

  1. Avatar for D001x_ErlandStevens 111. D001x_ErlandStevens Lv 1 6 pts. 9,117
  2. Avatar for johngran 112. johngran Lv 1 6 pts. 9,098
  3. Avatar for stomjoh 113. stomjoh Lv 1 6 pts. 9,098
  4. Avatar for Mydogisa Toelicker 114. Mydogisa Toelicker Lv 1 6 pts. 9,097
  5. Avatar for TK.Writer 115. TK.Writer Lv 1 5 pts. 9,092
  6. Avatar for Colostomy EXPLOSION. 116. Colostomy EXPLOSION. Lv 1 5 pts. 9,091
  7. Avatar for WarpSpeed 117. WarpSpeed Lv 1 5 pts. 9,087
  8. Avatar for fishercat 118. fishercat Lv 1 5 pts. 9,078
  9. Avatar for SouperGenious 119. SouperGenious Lv 1 5 pts. 9,064
  10. Avatar for JUMELLE54 120. JUMELLE54 Lv 1 5 pts. 9,049

Comments