Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,807
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,738
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,712
  4. Avatar for Go Science 4. Go Science 49 pts. 9,702
  5. Avatar for Contenders 5. Contenders 37 pts. 9,700
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,620
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,611
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 9,480
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,402
  10. Avatar for Deleted group 10. Deleted group pts. 9,386

  1. Avatar for Museka 41. Museka Lv 1 42 pts. 9,465
  2. Avatar for Mike Lewis 42. Mike Lewis Lv 1 41 pts. 9,463
  3. Avatar for christioanchauvin 43. christioanchauvin Lv 1 41 pts. 9,459
  4. Avatar for pauldunn 44. pauldunn Lv 1 40 pts. 9,457
  5. Avatar for alwen 45. alwen Lv 1 39 pts. 9,452
  6. Avatar for fiendish_ghoul 46. fiendish_ghoul Lv 1 38 pts. 9,439
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 37 pts. 9,404
  8. Avatar for Bushman 48. Bushman Lv 1 36 pts. 9,402
  9. Avatar for jobo0502 49. jobo0502 Lv 1 35 pts. 9,400
  10. Avatar for drumpeter18yrs9yrs 50. drumpeter18yrs9yrs Lv 1 34 pts. 9,386

Comments