Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for Mark-
    1. Mark- Lv 1
    100 pts. 8,906
  2. Avatar for LociOiling 2. LociOiling Lv 1 98 pts. 8,905
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 96 pts. 8,897
  4. Avatar for bertro 4. bertro Lv 1 94 pts. 8,891
  5. Avatar for mimi 5. mimi Lv 1 92 pts. 8,880
  6. Avatar for MurloW 6. MurloW Lv 1 90 pts. 8,876
  7. Avatar for Galaxie 7. Galaxie Lv 1 88 pts. 8,876
  8. Avatar for gitwut 8. gitwut Lv 1 86 pts. 8,863
  9. Avatar for gloverd 9. gloverd Lv 1 84 pts. 8,861
  10. Avatar for fiendish_ghoul 10. fiendish_ghoul Lv 1 82 pts. 8,855

Comments