Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 8,917
  2. Avatar for dembones 2. dembones Lv 1 88 pts. 8,913
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 77 pts. 8,912
  4. Avatar for mimi 4. mimi Lv 1 68 pts. 8,909
  5. Avatar for smilingone 5. smilingone Lv 1 59 pts. 8,905
  6. Avatar for LociOiling 6. LociOiling Lv 1 51 pts. 8,904
  7. Avatar for bertro 7. bertro Lv 1 44 pts. 8,901
  8. Avatar for reefyrob 8. reefyrob Lv 1 38 pts. 8,894
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 32 pts. 8,893
  10. Avatar for Galaxie 10. Galaxie Lv 1 27 pts. 8,872

Comments