Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,917
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,905
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 8,876
  4. Avatar for Go Science 4. Go Science 50 pts. 8,861
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 8,852
  6. Avatar for HMT heritage 6. HMT heritage 30 pts. 8,798
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 23 pts. 8,762
  8. Avatar for Void Crushers 8. Void Crushers 17 pts. 8,757
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 8,755
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,493
  1. Avatar for lamoille 11. lamoille Lv 1 23 pts. 8,866
  2. Avatar for MaartenDesnouck 12. MaartenDesnouck Lv 1 20 pts. 8,865
  3. Avatar for phi16 13. phi16 Lv 1 16 pts. 8,863
  4. Avatar for gmn 14. gmn Lv 1 14 pts. 8,860
  5. Avatar for gloverd 15. gloverd Lv 1 11 pts. 8,859
  6. Avatar for spvincent 16. spvincent Lv 1 9 pts. 8,855
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 8 pts. 8,853
  8. Avatar for Mike Lewis 18. Mike Lewis Lv 1 6 pts. 8,851
  9. Avatar for actiasluna 19. actiasluna Lv 1 5 pts. 8,851
  10. Avatar for Blipperman 20. Blipperman Lv 1 4 pts. 8,850

Comments