Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Contenders 100 pts. 8,917
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,905
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 8,876
  4. Avatar for Go Science 4. Go Science 50 pts. 8,861
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 8,852
  6. Avatar for HMT heritage 6. HMT heritage 30 pts. 8,798
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 23 pts. 8,762
  8. Avatar for Void Crushers 8. Void Crushers 17 pts. 8,757
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 8,755
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,493

  1. Avatar for Glen B 31. Glen B Lv 1 50 pts. 8,738
  2. Avatar for isaksson 32. isaksson Lv 1 49 pts. 8,731
  3. Avatar for SamuelJackson 33. SamuelJackson Lv 1 47 pts. 8,724
  4. Avatar for frood66 34. frood66 Lv 1 46 pts. 8,707
  5. Avatar for lynnai 35. lynnai Lv 1 45 pts. 8,697
  6. Avatar for johnmitch 36. johnmitch Lv 1 44 pts. 8,686
  7. Avatar for nicobul 37. nicobul Lv 1 43 pts. 8,686
  8. Avatar for grogar7 38. grogar7 Lv 1 42 pts. 8,685
  9. Avatar for Anfinsen_slept_here 40. Anfinsen_slept_here Lv 1 40 pts. 8,666

Comments