Placeholder image of a protein
Icon representing a puzzle

1225: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 8,603
  2. Avatar for Deleted group 22. Deleted group pts. 8,520
  3. Avatar for PSU Berks BMB 465 23. PSU Berks BMB 465 1 pt. 8,513

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,965
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 98 pts. 9,891
  3. Avatar for gloverd 3. gloverd Lv 1 96 pts. 9,870
  4. Avatar for frood66 4. frood66 Lv 1 94 pts. 9,863
  5. Avatar for bertro 5. bertro Lv 1 92 pts. 9,862
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 90 pts. 9,857
  7. Avatar for mirp 7. mirp Lv 1 88 pts. 9,853
  8. Avatar for KarenCH 8. KarenCH Lv 1 86 pts. 9,844
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 84 pts. 9,840
  10. Avatar for andrewxc 10. andrewxc Lv 1 82 pts. 9,839

Comments