Placeholder image of a protein
Icon representing a puzzle

1225: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 8,603
  2. Avatar for Deleted group 22. Deleted group pts. 8,520
  3. Avatar for PSU Berks BMB 465 23. PSU Berks BMB 465 1 pt. 8,513

  1. Avatar for scrubs2009 161. scrubs2009 Lv 1 1 pt. 9,368
  2. Avatar for gurch 162. gurch Lv 1 1 pt. 9,359
  3. Avatar for lockert 163. lockert Lv 1 1 pt. 9,350
  4. Avatar for ivalnic 164. ivalnic Lv 1 1 pt. 9,347
  5. Avatar for NotJim99 165. NotJim99 Lv 1 1 pt. 9,346
  6. Avatar for poiuyqwert 166. poiuyqwert Lv 1 1 pt. 9,342
  7. Avatar for spvincent 167. spvincent Lv 1 1 pt. 9,341
  8. Avatar for dak3910 168. dak3910 Lv 1 1 pt. 9,337
  9. Avatar for RaeRae61 169. RaeRae61 Lv 1 1 pt. 9,333
  10. Avatar for momadoc 170. momadoc Lv 1 1 pt. 9,330

Comments