1225: Revisiting Puzzle 150: Rosetta Decoy 12
Closed since almost 10 years ago
Intermediate Overall PredictionSummary
- Created
- April 26, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
