Placeholder image of a protein
Icon representing a puzzle

1225: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,965
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,897
  3. Avatar for Go Science 3. Go Science 63 pts. 9,870
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 9,850
  5. Avatar for Contenders 5. Contenders 37 pts. 9,831
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,799
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,788
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 15 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,768
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,704

  1. Avatar for gldisater 131. gldisater Lv 1 2 pts. 9,513
  2. Avatar for Pro Lapser 132. Pro Lapser Lv 1 2 pts. 9,501
  3. Avatar for theoracle94 133. theoracle94 Lv 1 1 pt. 9,500
  4. Avatar for Truncheon Luncheon 134. Truncheon Luncheon Lv 1 1 pt. 9,496
  5. Avatar for martinf 135. martinf Lv 1 1 pt. 9,493
  6. Avatar for drumpeter18yrs9yrs 136. drumpeter18yrs9yrs Lv 1 1 pt. 9,487
  7. Avatar for Mr_Jolty 137. Mr_Jolty Lv 1 1 pt. 9,486
  8. Avatar for demeter900 138. demeter900 Lv 1 1 pt. 9,470
  9. Avatar for placid.lion 139. placid.lion Lv 1 1 pt. 9,456
  10. Avatar for fishercat 140. fishercat Lv 1 1 pt. 9,448

Comments