Placeholder image of a protein
Icon representing a puzzle

1225: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,965
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,897
  3. Avatar for Go Science 3. Go Science 63 pts. 9,870
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 9,850
  5. Avatar for Contenders 5. Contenders 37 pts. 9,831
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,799
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,788
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 15 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,768
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,704

  1. Avatar for caglar 51. caglar Lv 1 28 pts. 9,718
  2. Avatar for Glen B 52. Glen B Lv 1 27 pts. 9,718
  3. Avatar for jobo0502 53. jobo0502 Lv 1 26 pts. 9,710
  4. Avatar for WBarme1234 54. WBarme1234 Lv 1 26 pts. 9,709
  5. Avatar for diamonddays 55. diamonddays Lv 1 25 pts. 9,705
  6. Avatar for decbin 56. decbin Lv 1 24 pts. 9,705
  7. Avatar for Bushman 57. Bushman Lv 1 23 pts. 9,704
  8. Avatar for petetrig 58. petetrig Lv 1 23 pts. 9,703
  9. Avatar for joremen 59. joremen Lv 1 22 pts. 9,702
  10. Avatar for SouperGenious 60. SouperGenious Lv 1 21 pts. 9,698

Comments