1225: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 10 years ago

Summary

• Created: April 26, 2016
• Expires: May 04, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

• 1. Beta Folders 100 pts. 9,965
• 2. Gargleblasters 80 pts. 9,897
• 3. Go Science 63 pts. 9,870
• 4. Anthropic Dreams 49 pts. 9,850
• 5. Contenders 37 pts. 9,831
• 6. L'Alliance Francophone 28 pts. 9,799
• 7. Void Crushers 21 pts. 9,788
• 8. D001x Med Chem MOOC 15 pts. 9,784
• 9. HMT heritage 11 pts. 9,768
• 10. Italiani Al Lavoro 8 pts. 9,704

Top soloists

• 11. Deleted player pts. 9,836
• 12. Scopper 78 pts. 9,835
• 13. Galaxie 76 pts. 9,833
• 14. gitwut 74 pts. 9,831
• 15. hpaege 72 pts. 9,823
• 16. pauldunn 71 pts. 9,818
• 17. mimi 69 pts. 9,817
• 18. actiasluna 67 pts. 9,814
• 19. smilingone 66 pts. 9,809
• 20. g_b 64 pts. 9,808