Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 9,642
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 9,556
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,185
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,844
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,695
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 8,402
  8. Avatar for xkcd 18. xkcd 1 pt. 7,740
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,602
  10. Avatar for Deleted group 20. Deleted group pts. 2,448

  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 10,312
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 10,286
  3. Avatar for Galaxie 3. Galaxie Lv 1 96 pts. 10,246
  4. Avatar for lynnai 4. lynnai Lv 1 94 pts. 10,229
  5. Avatar for gmn 5. gmn Lv 1 91 pts. 10,222
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 89 pts. 10,207
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 87 pts. 10,203
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 85 pts. 10,174
  9. Avatar for grogar7 9. grogar7 Lv 1 83 pts. 10,160
  10. Avatar for reefyrob 10. reefyrob Lv 1 81 pts. 10,141

Comments