Foldit

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created: May 02, 2016
Expires: May 09, 2016 at 23:00 UTC
Max points: 100

Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.

Sequence:

VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

11. Russian team 5 pts. 9,642
12. Italiani Al Lavoro 4 pts. 9,556
13. It's over 9000! 2 pts. 9,185
14. Natural Abilities 2 pts. 8,844
15. Team South Africa 1 pt. 8,746
16. BOINC@Poland 1 pt. 8,695
17. SETI.Germany 1 pt. 8,402
18. xkcd 1 pt. 7,740
19. DSN @ Home 1 pt. 4,602
20. Deleted group pts. 2,448

111. KarenCH Lv 1 3 pts. 9,267
112. xplocast1 Lv 1 3 pts. 9,240
113. gurch Lv 1 3 pts. 9,229
114. karost Lv 1 3 pts. 9,216
115. Deleted player pts. 9,212
116. Petrifolder Lv 1 3 pts. 9,188
117. BCAA Lv 1 2 pts. 9,185
118. dbuske Lv 1 2 pts. 9,168
119. jamiexq Lv 1 2 pts. 9,130
120. Squirrely Lv 1 2 pts. 9,125

Comments

jeff101 Lv 1

May 03, 2016

http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.