Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 9,642
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 9,556
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,185
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,844
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,695
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 8,402
  8. Avatar for xkcd 18. xkcd 1 pt. 7,740
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,602
  10. Avatar for Deleted group 20. Deleted group pts. 2,448

  1. Avatar for larry25427 201. larry25427 Lv 1 1 pt. 0
  2. Avatar for jflat06 202. jflat06 Lv 1 1 pt. 0
  3. Avatar for gldisater 203. gldisater Lv 1 1 pt. 0
  4. Avatar for decbin 204. decbin Lv 1 1 pt. 0
  5. Avatar for packer 205. packer Lv 1 1 pt. 0
  6. Avatar for ivalnic 206. ivalnic Lv 1 1 pt. 0
  7. Avatar for theoracle94 207. theoracle94 Lv 1 1 pt. 0
  8. Avatar for lockert 209. lockert Lv 1 1 pt. 0
  9. Avatar for frostschutz 210. frostschutz Lv 1 1 pt. 0

Comments