Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 9,642
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 9,556
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,185
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,844
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,695
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 8,402
  8. Avatar for xkcd 18. xkcd 1 pt. 7,740
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,602
  10. Avatar for Deleted group 20. Deleted group pts. 2,448

  1. Avatar for Glen B 41. Glen B Lv 1 36 pts. 9,857
  2. Avatar for johnmitch 42. johnmitch Lv 1 35 pts. 9,853
  3. Avatar for Origami314 43. Origami314 Lv 1 34 pts. 9,853
  4. Avatar for tallguy-13088 44. tallguy-13088 Lv 1 33 pts. 9,852
  5. Avatar for Deleted player 45. Deleted player pts. 9,849
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 31 pts. 9,819
  7. Avatar for harvardman 47. harvardman Lv 1 30 pts. 9,811
  8. Avatar for joremen 48. joremen Lv 1 29 pts. 9,802
  9. Avatar for nicobul 49. nicobul Lv 1 28 pts. 9,792
  10. Avatar for yoyoparis 50. yoyoparis Lv 1 27 pts. 9,790

Comments