Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 10,312
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 10,286
  3. Avatar for Galaxie 3. Galaxie Lv 1 96 pts. 10,246
  4. Avatar for lynnai 4. lynnai Lv 1 94 pts. 10,229
  5. Avatar for gmn 5. gmn Lv 1 91 pts. 10,222
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 89 pts. 10,207
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 87 pts. 10,203
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 85 pts. 10,174
  9. Avatar for grogar7 9. grogar7 Lv 1 83 pts. 10,160
  10. Avatar for reefyrob 10. reefyrob Lv 1 81 pts. 10,141

Comments