Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for ICHS Chemistry 2016 21. ICHS Chemistry 2016 1 pt. 0
  2. Avatar for Minions of TWIS 22. Minions of TWIS 1 pt. 0
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for JUMELLE54 91. JUMELLE54 Lv 1 7 pts. 9,495
  2. Avatar for hansvandenhof 92. hansvandenhof Lv 1 7 pts. 9,486
  3. Avatar for momadoc 93. momadoc Lv 1 6 pts. 9,460
  4. Avatar for altejoh 94. altejoh Lv 1 6 pts. 9,439
  5. Avatar for Superphosphate 95. Superphosphate Lv 1 6 pts. 9,434
  6. Avatar for pvc78 96. pvc78 Lv 1 6 pts. 9,432
  7. Avatar for arginia 97. arginia Lv 1 5 pts. 9,423
  8. Avatar for Simek 98. Simek Lv 1 5 pts. 9,410
  9. Avatar for justjustin 99. justjustin Lv 1 5 pts. 9,398
  10. Avatar for smholst 100. smholst Lv 1 5 pts. 9,389

Comments