Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for ICHS Chemistry 2016 21. ICHS Chemistry 2016 1 pt. 0
  2. Avatar for Minions of TWIS 22. Minions of TWIS 1 pt. 0
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for ecali 121. ecali Lv 1 2 pts. 9,121
  2. Avatar for deLaCeiba 122. deLaCeiba Lv 1 2 pts. 9,104
  3. Avatar for WBarme1234 123. WBarme1234 Lv 1 2 pts. 9,084
  4. Avatar for proteansoup 124. proteansoup Lv 1 2 pts. 9,077
  5. Avatar for rinze 125. rinze Lv 1 2 pts. 9,062
  6. Avatar for cynwulf28 126. cynwulf28 Lv 1 2 pts. 9,046
  7. Avatar for joaniegirl 127. joaniegirl Lv 1 2 pts. 9,042
  8. Avatar for zalbitr 128. zalbitr Lv 1 2 pts. 9,027
  9. Avatar for tarimo 129. tarimo Lv 1 1 pt. 9,019
  10. Avatar for nemo7731 130. nemo7731 Lv 1 1 pt. 9,017

Comments