Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Marvelz 161. Marvelz Lv 1 1 pt. 8,248
  2. Avatar for Truncheon Luncheon 162. Truncheon Luncheon Lv 1 1 pt. 8,230
  3. Avatar for D001x_David_2000 163. D001x_David_2000 Lv 1 1 pt. 8,209
  4. Avatar for BrKapr 164. BrKapr Lv 1 1 pt. 8,185
  5. Avatar for james_lemmate 165. james_lemmate Lv 1 1 pt. 8,143
  6. Avatar for SavageFolder 166. SavageFolder Lv 1 1 pt. 8,002
  7. Avatar for brow42 167. brow42 Lv 1 1 pt. 7,980
  8. Avatar for lamoille 168. lamoille Lv 1 1 pt. 7,910
  9. Avatar for HeEl 169. HeEl Lv 1 1 pt. 7,790
  10. Avatar for noxrenge 170. noxrenge Lv 1 1 pt. 7,787

Comments