Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for ICHS Chemistry 2016 21. ICHS Chemistry 2016 1 pt. 0
  2. Avatar for Minions of TWIS 22. Minions of TWIS 1 pt. 0
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for vacouch 171. vacouch Lv 1 1 pt. 7,782
  2. Avatar for fryguy 172. fryguy Lv 1 1 pt. 7,740
  3. Avatar for Wheeler22 173. Wheeler22 Lv 1 1 pt. 7,710
  4. Avatar for Stephen R 174. Stephen R Lv 1 1 pt. 7,637
  5. Avatar for kvasirthewise 175. kvasirthewise Lv 1 1 pt. 7,625
  6. Avatar for YumatovShow 176. YumatovShow Lv 1 1 pt. 7,543
  7. Avatar for DScott 177. DScott Lv 1 1 pt. 7,354
  8. Avatar for heyubob 178. heyubob Lv 1 1 pt. 7,313
  9. Avatar for Slipknotfruit 179. Slipknotfruit Lv 1 1 pt. 6,955
  10. Avatar for PrP9 180. PrP9 Lv 1 1 pt. 6,926

Comments