Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for ICHS Chemistry 2016 21. ICHS Chemistry 2016 1 pt. 0
  2. Avatar for Minions of TWIS 22. Minions of TWIS 1 pt. 0
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for O Seki To 11. O Seki To Lv 1 79 pts. 10,140
  2. Avatar for pauldunn 12. pauldunn Lv 1 77 pts. 10,137
  3. Avatar for bertro 13. bertro Lv 1 75 pts. 10,129
  4. Avatar for LociOiling 14. LociOiling Lv 1 73 pts. 10,123
  5. Avatar for mirp 15. mirp Lv 1 72 pts. 10,120
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 70 pts. 10,114
  7. Avatar for gitwut 17. gitwut Lv 1 68 pts. 10,111
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 66 pts. 10,063
  9. Avatar for fishercat 19. fishercat Lv 1 65 pts. 10,055
  10. Avatar for MurloW 20. MurloW Lv 1 63 pts. 10,046

Comments