Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Deleted player 191. Deleted player 1 pt. 4,463
  2. Avatar for Gwing16 192. Gwing16 Lv 1 1 pt. 4,032
  3. Avatar for Trippy Hippie 193. Trippy Hippie Lv 1 1 pt. 4,032
  4. Avatar for ManVsYard 194. ManVsYard Lv 1 1 pt. 4,032
  5. Avatar for MineWine 195. MineWine Lv 1 1 pt. 3,183
  6. Avatar for AW2017 196. AW2017 Lv 1 1 pt. 2,448
  7. Avatar for calphin 197. calphin Lv 1 1 pt. 2,345
  8. Avatar for jxt220 198. jxt220 Lv 1 1 pt. 2,122
  9. Avatar for Flagg65a 199. Flagg65a Lv 1 1 pt. 322
  10. Avatar for MrMark2014 200. MrMark2014 Lv 1 1 pt. 0

Comments