Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for boondog 61. boondog Lv 1 19 pts. 9,726
  2. Avatar for Fetztastic 62. Fetztastic Lv 1 19 pts. 9,718
  3. Avatar for jermainiac 63. jermainiac Lv 1 18 pts. 9,715
  4. Avatar for g_b 64. g_b Lv 1 18 pts. 9,710
  5. Avatar for Vinara 65. Vinara Lv 1 17 pts. 9,691
  6. Avatar for drumpeter18yrs9yrs 66. drumpeter18yrs9yrs Lv 1 17 pts. 9,685
  7. Avatar for Mike Cassidy 67. Mike Cassidy Lv 1 16 pts. 9,683
  8. Avatar for petetrig 68. petetrig Lv 1 15 pts. 9,679
  9. Avatar for ferzle 69. ferzle Lv 1 15 pts. 9,658
  10. Avatar for vakobo 70. vakobo Lv 1 14 pts. 9,642

Comments