Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Museka 71. Museka Lv 1 14 pts. 9,639
  2. Avatar for TastyMunchies 72. TastyMunchies Lv 1 14 pts. 9,632
  3. Avatar for YGK 73. YGK Lv 1 13 pts. 9,632
  4. Avatar for Bautho 74. Bautho Lv 1 13 pts. 9,623
  5. Avatar for andrewxc 75. andrewxc Lv 1 12 pts. 9,623
  6. Avatar for Crossed Sticks 76. Crossed Sticks Lv 1 12 pts. 9,620
  7. Avatar for stomjoh 77. stomjoh Lv 1 11 pts. 9,618
  8. Avatar for Maerim 78. Maerim Lv 1 11 pts. 9,606
  9. Avatar for alwen 79. alwen Lv 1 11 pts. 9,603
  10. Avatar for gcm24 80. gcm24 Lv 1 10 pts. 9,599

Comments