Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for ICHS Chemistry 2016 21. ICHS Chemistry 2016 1 pt. 0
  2. Avatar for Minions of TWIS 22. Minions of TWIS 1 pt. 0
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for mitarcher 81. mitarcher Lv 1 10 pts. 9,595
  2. Avatar for froggs554 82. froggs554 Lv 1 10 pts. 9,593
  3. Avatar for jobo0502 83. jobo0502 Lv 1 9 pts. 9,581
  4. Avatar for DodoBird 84. DodoBird Lv 1 9 pts. 9,574
  5. Avatar for YeshuaLives 85. YeshuaLives Lv 1 9 pts. 9,570
  6. Avatar for ratqueen03 86. ratqueen03 Lv 1 8 pts. 9,565
  7. Avatar for Bushman 87. Bushman Lv 1 8 pts. 9,556
  8. Avatar for Satina 88. Satina Lv 1 8 pts. 9,551
  9. Avatar for guineapig 89. guineapig Lv 1 7 pts. 9,536
  10. Avatar for freethought78 90. freethought78 Lv 1 7 pts. 9,522

Comments