Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,313
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,286
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 10,210
  4. Avatar for Go Science 4. Go Science 49 pts. 10,203
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,140
  6. Avatar for Contenders 6. Contenders 28 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,903
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 11 pts. 9,882
  10. Avatar for Deleted group 10. Deleted group pts. 9,685

  1. Avatar for SouperGenious 131. SouperGenious Lv 1 1 pt. 9,015
  2. Avatar for hada 132. hada Lv 1 1 pt. 9,002
  3. Avatar for leomisso 133. leomisso Lv 1 1 pt. 8,944
  4. Avatar for uihcv 134. uihcv Lv 1 1 pt. 8,931
  5. Avatar for TJOK fan 135. TJOK fan Lv 1 1 pt. 8,910
  6. Avatar for flojoe83 136. flojoe83 Lv 1 1 pt. 8,906
  7. Avatar for t012 137. t012 Lv 1 1 pt. 8,883
  8. Avatar for 01010011111 138. 01010011111 Lv 1 1 pt. 8,862
  9. Avatar for parsnip 139. parsnip Lv 1 1 pt. 8,851
  10. Avatar for Mr_Jolty 140. Mr_Jolty Lv 1 1 pt. 8,844

Comments