Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,313
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,286
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 10,210
  4. Avatar for Go Science 4. Go Science 49 pts. 10,203
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,140
  6. Avatar for Contenders 6. Contenders 28 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,903
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 11 pts. 9,882
  10. Avatar for Deleted group 10. Deleted group pts. 9,685

  1. Avatar for Jim Fraser 141. Jim Fraser Lv 1 1 pt. 8,834
  2. Avatar for FishKAA 142. FishKAA Lv 1 1 pt. 8,825
  3. Avatar for SadertdinovRamazan 143. SadertdinovRamazan Lv 1 1 pt. 8,824
  4. Avatar for mirjamvandelft 144. mirjamvandelft Lv 1 1 pt. 8,814
  5. Avatar for pansap99 145. pansap99 Lv 1 1 pt. 8,793
  6. Avatar for mark2000 146. mark2000 Lv 1 1 pt. 8,752
  7. Avatar for doctaven 147. doctaven Lv 1 1 pt. 8,746
  8. Avatar for martinf 148. martinf Lv 1 1 pt. 8,734
  9. Avatar for pandapharmd 149. pandapharmd Lv 1 1 pt. 8,712
  10. Avatar for kitek314_pl 150. kitek314_pl Lv 1 1 pt. 8,695

Comments