1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Summary

• Created: May 02, 2016
• Expires: May 09, 2016 at 23:00 UTC
• Max points: 100

Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:

VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

• 1. Anthropic Dreams 100 pts. 10,313
• 2. Gargleblasters 80 pts. 10,286
• 3. Beta Folders 63 pts. 10,210
• 4. Go Science 49 pts. 10,203
• 5. HMT heritage 37 pts. 10,140
• 6. Contenders 28 pts. 10,140
• 7. L'Alliance Francophone 21 pts. 9,968
• 8. Void Crushers 15 pts. 9,903
• 9. D001x Med Chem MOOC 11 pts. 9,882
• 10. Deleted group pts. 9,685

Top soloists

• 51. Scopper 27 pts. 9,788
• 52. martin.szew 26 pts. 9,788
• 53. pmdpmd 25 pts. 9,781
• 54. cbwest 24 pts. 9,769
• 55. Merf 23 pts. 9,766
• 56. smilingone 23 pts. 9,763
• 57. diamond_dust 22 pts. 9,759
• 58. SKSbell 21 pts. 9,753
• 59. caglar 21 pts. 9,750
• 60. Punktchen 20 pts. 9,749

Comments

[jeff101]

http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.