Placeholder image of a protein
Icon representing a puzzle

1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 04, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,621
  2. Avatar for Deleted group 12. Deleted group pts. 9,582
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,447
  4. Avatar for xkcd 14. xkcd 1 pt. 9,274
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,002
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,853
  7. Avatar for Deleted group 17. Deleted group pts. 8,085

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,193
  2. Avatar for LociOiling 2. LociOiling Lv 1 86 pts. 10,183
  3. Avatar for reefyrob 3. reefyrob Lv 1 73 pts. 10,176
  4. Avatar for Deleted player 4. Deleted player 62 pts. 10,142
  5. Avatar for bertro 5. bertro Lv 1 52 pts. 10,142
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 43 pts. 10,140
  7. Avatar for Deleted player 7. Deleted player pts. 10,111
  8. Avatar for Galaxie 8. Galaxie Lv 1 30 pts. 10,094
  9. Avatar for lamoille 9. lamoille Lv 1 24 pts. 10,074
  10. Avatar for gmn 10. gmn Lv 1 20 pts. 10,071

Comments