Placeholder image of a protein
Icon representing a puzzle

1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 04, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,621
  2. Avatar for Deleted group 12. Deleted group pts. 9,582
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,447
  4. Avatar for xkcd 14. xkcd 1 pt. 9,274
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,002
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,853
  7. Avatar for Deleted group 17. Deleted group pts. 8,085

  1. Avatar for heyubob 151. heyubob Lv 1 1 pt. 9,053
  2. Avatar for momadoc 152. momadoc Lv 1 1 pt. 9,041
  3. Avatar for sekisisoul 153. sekisisoul Lv 1 1 pt. 9,036
  4. Avatar for flojoe83 154. flojoe83 Lv 1 1 pt. 9,036
  5. Avatar for bwkittitas 155. bwkittitas Lv 1 1 pt. 9,026
  6. Avatar for GreekCivilization 156. GreekCivilization Lv 1 1 pt. 9,020
  7. Avatar for pansap99 157. pansap99 Lv 1 1 pt. 9,019
  8. Avatar for mark2000 158. mark2000 Lv 1 1 pt. 9,016
  9. Avatar for Igor_Holowacz 159. Igor_Holowacz Lv 1 1 pt. 9,009
  10. Avatar for thewholeblahthing 160. thewholeblahthing Lv 1 1 pt. 9,008

Comments