Placeholder image of a protein
Icon representing a puzzle

1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 04, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,621
  2. Avatar for Deleted group 12. Deleted group pts. 9,582
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,447
  4. Avatar for xkcd 14. xkcd 1 pt. 9,274
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,002
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,853
  7. Avatar for Deleted group 17. Deleted group pts. 8,085

  1. Avatar for Crossed Sticks 61. Crossed Sticks Lv 1 16 pts. 9,657
  2. Avatar for Glen B 62. Glen B Lv 1 15 pts. 9,651
  3. Avatar for BCAA 63. BCAA Lv 1 15 pts. 9,649
  4. Avatar for guineapig 64. guineapig Lv 1 14 pts. 9,643
  5. Avatar for hpaege 65. hpaege Lv 1 13 pts. 9,626
  6. Avatar for t012 66. t012 Lv 1 13 pts. 9,624
  7. Avatar for deLaCeiba 67. deLaCeiba Lv 1 13 pts. 9,621
  8. Avatar for uihcv 68. uihcv Lv 1 12 pts. 9,615
  9. Avatar for jobo0502 69. jobo0502 Lv 1 12 pts. 9,608
  10. Avatar for ecali 70. ecali Lv 1 11 pts. 9,596

Comments