1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 10 years ago

Summary

• Created: May 04, 2016
• Expires: May 12, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

• 1. Beta Folders 100 pts. 10,193
• 2. Anthropic Dreams 73 pts. 10,094
• 3. Contenders 52 pts. 10,056
• 4. Go Science 36 pts. 10,032
• 5. Gargleblasters 24 pts. 9,973
• 6. Void Crushers 16 pts. 9,925
• 7. HMT heritage 10 pts. 9,879
• 8. D001x Med Chem MOOC 6 pts. 9,870
• 9. L'Alliance Francophone 4 pts. 9,837
• 10. It's over 9000! 2 pts. 9,649

Top evolvers

• 11. jamiexq 16 pts. 10,058
• 12. gitwut 13 pts. 10,053
• 13. MaartenDesnouck 10 pts. 10,049
• 14. Bruno Kestemont 8 pts. 10,032
• 15. gloverd 6 pts. 10,027
• 16. jermainiac 5 pts. 10,025
• 17. alwen 4 pts. 10,025
• 18. packer 3 pts. 10,019
• 19. Bletchley Park 2 pts. 10,014
• 20. DodoBird 2 pts. 10,012