Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,489
  2. Avatar for xkcd 12. xkcd 1 pt. 9,484
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,460
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,405
  5. Avatar for Freedom Folders 15. Freedom Folders 1 pt. 9,374
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 9,147

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 10,172
  2. Avatar for LociOiling 2. LociOiling Lv 1 85 pts. 10,168
  3. Avatar for Deleted player 3. Deleted player 71 pts. 10,167
  4. Avatar for Deleted player 4. Deleted player pts. 10,167
  5. Avatar for smilingone 5. smilingone Lv 1 49 pts. 10,166
  6. Avatar for bertro 6. bertro Lv 1 41 pts. 10,129
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 33 pts. 10,027
  8. Avatar for Galaxie 8. Galaxie Lv 1 27 pts. 9,960
  9. Avatar for mirp 9. mirp Lv 1 22 pts. 9,958
  10. Avatar for ManVsYard 10. ManVsYard Lv 1 17 pts. 9,955

Comments