Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,489
  2. Avatar for xkcd 12. xkcd 1 pt. 9,484
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,460
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,405
  5. Avatar for Freedom Folders 15. Freedom Folders 1 pt. 9,374
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 9,147
  1. Avatar for 123kassidy123 171. 123kassidy123 Lv 1 1 pt. 8,460
  2. Avatar for ivalnic5 172. ivalnic5 Lv 1 1 pt. 8,448
  3. Avatar for sean4046 173. sean4046 Lv 1 1 pt. 8,387
  4. Avatar for PrP9 174. PrP9 Lv 1 1 pt. 8,311
  5. Avatar for 01010011111 175. 01010011111 Lv 1 1 pt. 8,246
  6. Avatar for lscfoldit15 176. lscfoldit15 Lv 1 1 pt. 7,869
  7. Avatar for RAH 177. RAH Lv 1 1 pt. 7,869
  8. Avatar for SKAT1990 178. SKAT1990 Lv 1 1 pt. 7,869
  9. Avatar for packer 179. packer Lv 1 1 pt. 7,869
  10. Avatar for ivalnic 180. ivalnic Lv 1 1 pt. 7,869

Comments