Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,489
  2. Avatar for xkcd 12. xkcd 1 pt. 9,484
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,460
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,405
  5. Avatar for Freedom Folders 15. Freedom Folders 1 pt. 9,374
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 9,147
  1. Avatar for Museka 71. Museka Lv 1 10 pts. 9,464
  2. Avatar for BCAA 72. BCAA Lv 1 9 pts. 9,460
  3. Avatar for ecali 73. ecali Lv 1 9 pts. 9,441
  4. Avatar for tarimo 74. tarimo Lv 1 9 pts. 9,440
  5. Avatar for phi16 75. phi16 Lv 1 8 pts. 9,432
  6. Avatar for uihcv 76. uihcv Lv 1 8 pts. 9,430
  7. Avatar for Crossed Sticks 77. Crossed Sticks Lv 1 8 pts. 9,427
  8. Avatar for JUMELLE54 78. JUMELLE54 Lv 1 7 pts. 9,412
  9. Avatar for kitek314_pl 79. kitek314_pl Lv 1 7 pts. 9,405
  10. Avatar for decbin 80. decbin Lv 1 7 pts. 9,385

Comments