Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,489
  2. Avatar for xkcd 12. xkcd 1 pt. 9,484
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,460
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,405
  5. Avatar for Freedom Folders 15. Freedom Folders 1 pt. 9,374
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 9,147
  1. Avatar for weurhartdezirez 81. weurhartdezirez Lv 1 6 pts. 9,374
  2. Avatar for weitzen 82. weitzen Lv 1 6 pts. 9,369
  3. Avatar for Graham MF 83. Graham MF Lv 1 6 pts. 9,362
  4. Avatar for SKSbell 84. SKSbell Lv 1 6 pts. 9,346
  5. Avatar for pfirth 85. pfirth Lv 1 5 pts. 9,336
  6. Avatar for sheerbliss 86. sheerbliss Lv 1 5 pts. 9,313
  7. Avatar for Deleted player 87. Deleted player pts. 9,313
  8. Avatar for nemo7731 88. nemo7731 Lv 1 5 pts. 9,305
  9. Avatar for ratqueen03 89. ratqueen03 Lv 1 4 pts. 9,297
  10. Avatar for crpainter 90. crpainter Lv 1 4 pts. 9,288

Comments