1232: Revisiting Puzzle 157: Rosetta Decoy 14
Closed since almost 10 years ago
Intermediate Overall PredictionSummary
- Created
- May 11, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL