Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,172
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,965
  3. Avatar for Go Science 3. Go Science 49 pts. 9,958
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,955
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,938
  6. Avatar for Contenders 6. Contenders 14 pts. 9,916
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,901
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,882
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 3 pts. 9,642
  10. Avatar for Deleted group 10. Deleted group pts. 9,637

  1. Avatar for bhodg1 181. bhodg1 Lv 1 1 pt. 7,869
  2. Avatar for t012 182. t012 Lv 1 1 pt. 7,869
  3. Avatar for Zun 183. Zun Lv 1 1 pt. 7,869
  4. Avatar for GingerInferno 184. GingerInferno Lv 1 1 pt. 7,869
  5. Avatar for heyubob 185. heyubob Lv 1 1 pt. 7,869
  6. Avatar for vawalker 186. vawalker Lv 1 1 pt. 7,869

Comments