Placeholder image of a protein
Icon representing a puzzle

1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,687
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,570
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,418
  4. Avatar for xkcd 14. xkcd 1 pt. 9,214
  5. Avatar for Australia 15. Australia 1 pt. 9,141
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,066
  7. Avatar for LCC Organic Chemistry 17. LCC Organic Chemistry 1 pt. 9,011
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,901
  1. Avatar for Close At Hand 101. Close At Hand Lv 1 3 pts. 9,362
  2. Avatar for bullmoose3 102. bullmoose3 Lv 1 3 pts. 9,358
  3. Avatar for ivalnic 103. ivalnic Lv 1 3 pts. 9,355
  4. Avatar for Punktchen 104. Punktchen Lv 1 3 pts. 9,350
  5. Avatar for pandapharmd 105. pandapharmd Lv 1 3 pts. 9,349
  6. Avatar for ppp6 106. ppp6 Lv 1 3 pts. 9,345
  7. Avatar for wudoo 107. wudoo Lv 1 2 pts. 9,333
  8. Avatar for fokereke 108. fokereke Lv 1 2 pts. 9,328
  9. Avatar for jebbiek 109. jebbiek Lv 1 2 pts. 9,298
  10. Avatar for inuyasha10121 110. inuyasha10121 Lv 1 2 pts. 9,296

Comments