Placeholder image of a protein
Icon representing a puzzle

1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 9,687
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,570
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,418
  4. Avatar for xkcd 14. xkcd 1 pt. 9,214
  5. Avatar for Australia 15. Australia 1 pt. 9,141
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,066
  7. Avatar for LCC Organic Chemistry 17. LCC Organic Chemistry 1 pt. 9,011
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,901

  1. Avatar for poiuyqwert 161. poiuyqwert Lv 1 1 pt. 8,965
  2. Avatar for anik 162. anik Lv 1 1 pt. 8,962
  3. Avatar for momadoc 163. momadoc Lv 1 1 pt. 8,932
  4. Avatar for shadowking29 164. shadowking29 Lv 1 1 pt. 8,931
  5. Avatar for AZX 165. AZX Lv 1 1 pt. 8,920
  6. Avatar for jarbolol15 166. jarbolol15 Lv 1 1 pt. 8,906
  7. Avatar for derrickthewhite 167. derrickthewhite Lv 1 1 pt. 8,903
  8. Avatar for aspadistra 168. aspadistra Lv 1 1 pt. 8,901
  9. Avatar for larry25427 169. larry25427 Lv 1 1 pt. 8,866
  10. Avatar for tela 170. tela Lv 1 1 pt. 8,860

Comments