1235: Revisiting Puzzle 165: Rosetta Decoy 15
Closed since almost 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- May 17, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV