Placeholder image of a protein
Icon representing a puzzle

1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,215
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,089
  3. Avatar for Contenders 3. Contenders 54 pts. 10,008
  4. Avatar for Go Science 4. Go Science 38 pts. 9,997
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,969
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,901
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,889
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 9,889
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 5 pts. 9,847
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,712

  1. Avatar for Inkedhands 121. Inkedhands Lv 1 1 pt. 9,224
  2. Avatar for dbuske 122. dbuske Lv 1 1 pt. 9,223
  3. Avatar for martinf 123. martinf Lv 1 1 pt. 9,217
  4. Avatar for fryguy 124. fryguy Lv 1 1 pt. 9,214
  5. Avatar for hada 125. hada Lv 1 1 pt. 9,213
  6. Avatar for Tac1 126. Tac1 Lv 1 1 pt. 9,191
  7. Avatar for xavierhochart 127. xavierhochart Lv 1 1 pt. 9,177
  8. Avatar for aznarog 128. aznarog Lv 1 1 pt. 9,162
  9. Avatar for Blakenator 129. Blakenator Lv 1 1 pt. 9,146
  10. Avatar for willanth 130. willanth Lv 1 1 pt. 9,141

Comments