Placeholder image of a protein
Icon representing a puzzle

1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,215
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,089
  3. Avatar for Contenders 3. Contenders 54 pts. 10,008
  4. Avatar for Go Science 4. Go Science 38 pts. 9,997
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,969
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,901
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,889
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 9,889
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 5 pts. 9,847
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,712
  1. Avatar for harvardman 171. harvardman Lv 1 1 pt. 8,857
  2. Avatar for lamoille 172. lamoille Lv 1 1 pt. 8,855
  3. Avatar for Jacob1018 173. Jacob1018 Lv 1 1 pt. 8,853
  4. Avatar for cynwulf28 174. cynwulf28 Lv 1 1 pt. 8,852
  5. Avatar for NotJim99 175. NotJim99 Lv 1 1 pt. 8,850
  6. Avatar for RaeRae61 176. RaeRae61 Lv 1 1 pt. 8,849
  7. Avatar for t012 177. t012 Lv 1 1 pt. 8,722
  8. Avatar for CEiben 178. CEiben Lv 1 1 pt. 8,661
  9. Avatar for ventus14 179. ventus14 Lv 1 1 pt. 8,654
  10. Avatar for Aidanm 180. Aidanm Lv 1 1 pt. 8,548

Comments