Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621
  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,104
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 87 pts. 9,104
  3. Avatar for dembones 3. dembones Lv 1 75 pts. 9,101
  4. Avatar for smilingone 4. smilingone Lv 1 64 pts. 9,095
  5. Avatar for LociOiling 5. LociOiling Lv 1 55 pts. 9,094
  6. Avatar for reefyrob 6. reefyrob Lv 1 47 pts. 9,088
  7. Avatar for TomTaylor 7. TomTaylor Lv 1 40 pts. 9,085
  8. Avatar for Deleted player 8. Deleted player pts. 9,053
  9. Avatar for Blipperman 9. Blipperman Lv 1 28 pts. 9,028
  10. Avatar for Mike Lewis 10. Mike Lewis Lv 1 23 pts. 9,027

Comments