Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621
  1. Avatar for mitarcher 111. mitarcher Lv 1 2 pts. 7,964
  2. Avatar for 77doc7 112. 77doc7 Lv 1 2 pts. 7,948
  3. Avatar for wosser1 113. wosser1 Lv 1 2 pts. 7,941
  4. Avatar for dbuske 114. dbuske Lv 1 2 pts. 7,870
  5. Avatar for demeter900 115. demeter900 Lv 1 2 pts. 7,859
  6. Avatar for rinze 116. rinze Lv 1 2 pts. 7,833
  7. Avatar for Punktchen 117. Punktchen Lv 1 1 pt. 7,825
  8. Avatar for NotJim99 118. NotJim99 Lv 1 1 pt. 7,816
  9. Avatar for SouperGenious 119. SouperGenious Lv 1 1 pt. 7,815
  10. Avatar for Z3R0 D4T4 120. Z3R0 D4T4 Lv 1 1 pt. 7,805

Comments